missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABRO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 549.00 €
Specifications
| Antigen | ABRO |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18496261
|
Novus Biologicals
NBP1-90282-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18232488
|
Novus Biologicals
NBP1-90282 |
0.1 mL |
549.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ABRO Polyclonal antibody specifically detects ABRO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| ABRO | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| Abraxas brother protein 1, ABRO1abraxas brother 1, Em:AC068896.4, family with sequence similarity 175, member B, FLJ22338, KIAA0157BRISC complex subunit Abro1, Protein FAM175B | |
| ABRAXAS2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human ABRO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 23172 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title