missing translation for 'onlineSavingsMsg'
Learn More

ACCN5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-83258-25ul

View more versions of this product

Product Code. 18467210

433.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ACCN5 Polyclonal specifically detects ACCN5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ACCN5
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.	Q9NY37
Gene Symbols	ASIC5
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	amiloride-sensitive cation channel 5, intestinal
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	51802
Target Species	Human
Isotype	IgG

Suggerimenti di prodotto

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Il vostro nome

Indirizzo e-mail *

Tipo di problema *

Descrizione dettagliata del problema/richiesta *

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Annulla Invia

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato

For Research Use Only

Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto

ACCN5 Antibody, Novus Biologicals™

Description

Specifications

Suggerimenti di prodotto

Documenti

Promozioni