missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62689-25ul
This item is not returnable.
View return policy
Description
ADAM11 Polyclonal antibody specifically detects ADAM11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ADAM11 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| a disintegrin and metalloproteinase domain 11, ADAM metallopeptidase domain 11, disintegrin and metalloproteinase domain-containing protein 11, MDCADAM 11, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR | |
| 25 μL | |
| Signal Transduction | |
| 4185 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction