missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AdipoR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91652
This item is not returnable.
View return policy
Description
AdipoR2 Polyclonal antibody specifically detects AdipoR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| AdipoR2 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 | |
| ACDCR2, adiponectin receptor 2, adiponectin receptor protein 2, FLJ21432, PAQR2MGC4640, Progestin and adipoQ receptor family member II | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS | |
| 0.1 mL | |
| Signal Transduction | |
| 79602 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction