missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGXT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
288.00 € - 539.00 €
Specifications
| Antigen | AGXT2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18453941
|
Novus Biologicals
NBP1-89199-25ul |
25 μL |
288.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18284607
|
Novus Biologicals
NBP1-89199 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AGXT2 Polyclonal specifically detects AGXT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| AGXT2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9BYV1 | |
| 64902 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DVRGKGLMIGIEMVQDKISCRPLPREEVNQIHEDCKHMGLLVGRGSIFSQTFRIAPSMCITKPEVDFAVEVFRSALTQHMERRAK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| (R)-3-amino-2-methylpropionate--pyruvate transaminase, AGT 2, alanine-glyoxylate aminotransferase 2, alanine--glyoxylate aminotransferase 2, Beta-ALAAT II, Beta-alanine-pyruvate aminotransferase, DAIBAT, D-AIBAT, EC 2.6.1.40, EC 2.6.1.44, mitochondrial | |
| AGXT2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title