missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ AGXT2L1 Recombinant Protein Antigen

Product Code. 18258082 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18258082 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18258082 Supplier Novus Biologicals™ Supplier No. NBP257397PEP
 Restricted Item
Estimated Shipment: 19-10-2026
Add to basket
Añadir a la cesta
Este artículo no se puede devolver. Vea la política de devoluciones

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2L1. Source: E.coli Amino Acid Sequence: LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA The AGXT2L1 Recombinant Protein Antigen is derived from E. coli. The AGXT2L1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Especificaciones

Gene ID (Entrez) 64850
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name AGXT2L1 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias alanine--glyoxylate aminotransferase 2-like 1, alanine-glyoxylate aminotransferase 2-like 1, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.44
Gene Symbol AGXT2L1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50907. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mostrar más Mostrar menos

For Research Use Only.

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.