missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AK3L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48773-25ul
This item is not returnable.
View return policy
Description
AK3L1 Polyclonal antibody specifically detects AK3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| AK3L1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| adenylate kinase 3, Adenylate kinase 3-like, adenylate kinase 3-like 1, adenylate kinase 4, AK3adenylate kinase isoenzyme 4, mitochondrial, AK3L1, AK3L2, ATP-AMP transphosphorylase, EC 2.7.4, EC 2.7.4.3, GTP:AMP phosphotransferase, MGC166959, mitochondrial adenylate kinase-3, nucleoside-triphosphate-adenylate kinase | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLD | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 205 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction