missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AKT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
386.00 € - 500.00 €
Specifications
| Antigen | AKT3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18440591
|
Novus Biologicals
NBP1-80900-25ul |
25ul |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18239125
|
Novus Biologicals
NBP1-80900 |
0.1 mL |
500.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AKT3 Polyclonal specifically detects AKT3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| AKT3 | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Akt-3, EC 2.7.11, EC 2.7.11.1, PKB gamma, PKBGDKFZp434N0250, PRKBG, v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) | |
| AKT3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Q9Y243, Q9Y243, Q9Y243, Q9Y243 | |
| 10000 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title