missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alcohol dehydrogenase 6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62658-25ul
This item is not returnable.
View return policy
Description
alcohol dehydrogenase 6 Polyclonal antibody specifically detects alcohol dehydrogenase 6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| alcohol dehydrogenase 6 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| ADH-5, alcohol dehydrogenase 6, alcohol dehydrogenase 6 (class V), aldehyde reductase, EC 1.1.1, EC 1.1.1.1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG | |
| 25 μL | |
| Signal Transduction | |
| 130 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction