missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALDH1A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
406.00 € - 565.00 €
Specifications
| Antigen | ALDH1A3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18474182
|
Novus Biologicals
NBP1-91657-25ul |
25 μL |
406.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18776173
|
Novus Biologicals
NBP1-91657 |
565.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
ALDH1A3 Polyclonal specifically detects ALDH1A3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| ALDH1A3 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3 | |
| ALDH1A3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| P47895 | |
| 220 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 56 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title