missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALOXE3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | ALOXE3 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667446
|
Novus Biologicals
NBP2-62727-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681059
|
Novus Biologicals
NBP2-62727 |
100 μg |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ALOXE3 Polyclonal antibody specifically detects ALOXE3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ALOXE3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 59344 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| arachidonate lipoxygenase 3, EC 1.13.11.-, E-LOX, eLOX3, e-LOX-3, epidermal lipoxygenase, epidermis-type lipoxygenase 3, MGC119694, MGC119695, MGC119696 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title