missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AlphaA Crystallin/CRYAA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | AlphaA Crystallin/CRYAA |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18242351
|
Novus Biologicals
NBP2-55161 |
100 μL |
529.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18648566
|
Novus Biologicals
NBP2-55161-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AlphaA Crystallin/CRYAA Polyclonal specifically detects AlphaA Crystallin/CRYAA in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| AlphaA Crystallin/CRYAA | |
| Polyclonal | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1409 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4 | |
| CRYAA | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title