missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ALS2CR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90183-25ul
This item is not returnable.
View return policy
Description
ALS2CR2 Polyclonal antibody specifically detects ALS2CR2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ALS2CR2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9C0K7 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| ALS2CR2candidate 2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein, CALS-21MGC102916, ILP-interacting protein, ILPIPSTRAD beta, Pseudokinase ALS2CR2, STE20-related kinase adaptor beta | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS | |
| 25 μL | |
| Apoptosis, Protein Kinase, Signal Transduction | |
| 55437 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction