missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aminopeptidase P2/XPNPEP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21303-25ul
This item is not returnable.
View return policy
Description
Aminopeptidase P2/XPNPEP2 Polyclonal antibody specifically detects Aminopeptidase P2/XPNPEP2 in Human samples. It is validated for Immunofluorescence
Specifications
| Aminopeptidase P2/XPNPEP2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Aminoacylproline aminopeptidase, APP2, EC 3.4.11.9, mAmP, Membrane-bound aminopeptidase P, Membrane-bound AmP, Membrane-bound APP, xaa-Pro aminopeptidase 2, X-Pro aminopeptidase 2, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7512 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction