missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMPK beta 1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92961-0.02ml
This item is not returnable.
View return policy
Description
AMPK beta 1 Polyclonal antibody specifically detects AMPK beta 1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-Out
Specifications
| AMPK beta 1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:100, Knockout Validated | |
| 5'-AMP-activated protein kinase beta-1 subunit, AMP-activated protein kinase beta subunit, AMPK, AMPK beta -1 chain, AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb, HAMPKb, MGC17785, protein kinase, AMP-activated, beta 1 non-catalytic subunit, protein kinase, AMP-activated, noncatalytic, beta-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human AMPK beta 1 (NP_006244.2). MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPT | |
| 0.02 mL | |
| Cancer, Hypoxia, mTOR Pathway | |
| 5564 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence, Gene Knock-Out | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction