missing translation for 'onlineSavingsMsg'
Learn More

ANKRD22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-81167-25ul

View more versions of this product

Product Code. 18440181

292.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ANKRD22 Polyclonal specifically detects ANKRD22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	ANKRD22
Classification	Polyclonal
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Gene Accession No.	Q5VYY1
Gene Symbols	ANKRD22
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	118932
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ankyrin repeat domain 22, ankyrin repeat domain-containing protein 22, MGC22805
Host Species	Rabbit
Molecular Weight of Antigen	22 kDa
Quantity	25ul
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

ANKRD22 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions