missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18127009

Novus Biologicals™ ANKRD36C Recombinant Protein Antigen

Product Code. 18127009 Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 18127009

Brand: Novus Biologicals™ NBP254945PEP

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANKRD36C. Source: E.coli Amino Acid Sequence: KDEQISGTVSSQKQPALKATSDKKDSVSNIPTEIKDGQQSGTVSSQKQLAWKATSVKKDSVSNIATEIKDGQIRGTVS The ANKRD36C Recombinant Protein Antigen is derived from E. coli. The ANKRD36C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gene ID (Entrez) 400986
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name ANKRD36C Recombinant Protein Antigen
Content And Storage −20°C, avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias Ankyrin Repeat Domain 36C, Protein Immuno-Reactive With Anti-PTH Polyclonal Antibodies
Gene Symbol N/A
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50209. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For research use only.

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.