missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein E R2/ApoE R2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 574.00 €
Specifications
| Antigen | Apolipoprotein E R2/ApoE R2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625387
|
Novus Biologicals
NBP2-62680-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647818
|
Novus Biologicals
NBP2-62680 |
100 μg |
574.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Apolipoprotein E R2/ApoE R2 Polyclonal antibody specifically detects Apolipoprotein E R2/ApoE R2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Apolipoprotein E R2/ApoE R2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Alzheimers Research, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 7804 | |
| IgG | |
| Protein A purified |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| APOER2HSZ75190, Apolipoprotein E receptor 2, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor, low-density lipoprotein receptor-related protein 8, LRP-8, MCI1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title