missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
204.00 € - 463.00 €
Specifications
| Antigen | Aquaporin-4 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690782
|
Novus Biologicals
NBP2-92886-0.02ml |
0.02 mL |
204.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664752
|
Novus Biologicals
NBP2-92886-0.1ml |
0.1 mL |
463.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Aquaporin-4 Polyclonal antibody specifically detects Aquaporin-4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Aquaporin-4 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 361 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| aquaporin 4, MGC22454 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (NP_001641.1). VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title