missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-9 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92558-0.02ml
This item is not returnable.
View return policy
Description
Aquaporin-9 Polyclonal antibody specifically detects Aquaporin-9 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Aquaporin-9 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| AQP-9, Aquaglyceroporin-9, aquaporin 9, aquaporin-9, HsT17287, Small solute channel 1, SSC1aquaglyceroporin-9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human Aquaporin-9 (NP_066190.2). SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 366 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction