missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARHGEF3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | ARHGEF3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246234
|
Novus Biologicals
NBP2-57422 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678356
|
Novus Biologicals
NBP2-57422-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARHGEF3 Polyclonal specifically detects ARHGEF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ARHGEF3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 50650 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| DKFZP434F2429, Exchange factor found in platelets and leukemic and neuronal tissues, FLJ98126, MGC118905, Rho guanine nucleotide exchange factor (GEF) 3, rho guanine nucleotide exchange factor 3,59.8 kDA protein, RhoGEF protein, XPLNXPLN | |
| ARHGEF3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title