missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ASC/TMS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49133
This item is not returnable.
View return policy
Description
ASC/TMS1 Polyclonal antibody specifically detects ASC/TMS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ASC/TMS1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| apoptosis-associated speck-like protein containing a CARD, ASC, CARD5, caspase recruitment domain protein 5, Caspase recruitment domain-containing protein 5, hASC, PYCARD, PYD and CARD domain-containing protein, Target of methylation-induced silencing 1, TMS, TMS1, TMS-1 | |
| This ASC/TMS1 Antibody was developed against a recombinant protein corresponding to amino acids: GALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHR | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Inflammation, Innate Immunity | |
| 29108 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction