missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATG16L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49408-25ul
This item is not returnable.
View return policy
Description
ATG16L1 Polyclonal antibody specifically detects ATG16L1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ATG16L1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| APG16 autophagy 16-like (S. cerevisiae), APG16L beta, APG16LFLJ10828, APG16-like 1, ATG16 autophagy related 16-like (S. cerevisiae), ATG16 autophagy related 16-like 1 (S. cerevisiae), ATG16A, ATG16L, autophagy-related protein 16-1, FLJ00045, FLJ10035, FLJ22677, IBD10, WD repeat domain 30, WDR30 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDA | |
| 25 μL | |
| Autophagy, Cancer, Cell Biology, Macroautophagy, Neurodegeneration, Neuroscience, Tumor Suppressors, Ubiquitin Proteasome Pathway | |
| 55054 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction