missing translation for 'onlineSavingsMsg'
Learn More

ATP13A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-30651

View more versions of this product

Product Code. 18140834

624.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

ATP13A1 Polyclonal specifically detects ATP13A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

Antigen	ATP13A1
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.	Q9HD20
Gene Symbols	ATP13A1
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ATP13A, ATPase type 13A, ATPase type 13A1, cation transporting ATPase, CGI-152, DKFZp761L1623, EC 3.6.3, EC 3.6.3.-, EC 3.6.3.12, FLJ31858, FLJ41786, FLJ43873, KIAA1825FLJ90317, probable cation-transporting ATPase 13A1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	57130
Target Species	Human
Isotype	IgG

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

ATP13A1 Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen