ATP5S Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-14333-25ul

Afficher plus de versions de ce produit

Code produit. 18434221

369.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

ATP5S Polyclonal specifically detects ATP5S in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spécification

Antigen	ATP5S
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	ATP synthase coupling factor B-like 1, ATP synthase subunit s, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit s (factor B), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B), ATP synthase-coupling factor B, ATPWATP synthase coupling factor B, mitochondrial, HSU79253, Mitochondrial ATP synthase regulatory component factor B
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	27109
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	ATP5S
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: MCCAVSEQRLTCADQMMLFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRC
Quantity	25ul
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

ATP5S Antibody, Novus Biologicals™

Description

Spécification

Produktvorschläge

Dokumentation

Aktionen