missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1E2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92065-0.02ml
This item is not returnable.
View return policy
Description
ATP6V1E2 Polyclonal antibody specifically detects ATP6V1E2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| ATP6V1E2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| ATP6E1V-ATPase subunit E 2, ATP6EL2, ATP6V1EL2, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD-like 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 2, ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2, MGC9341, Vacuolar proton pump subunit E 2, vacuolar-type proton-translocating ATPase subunit E1, VMA4, V-type proton ATPase subunit E 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human ATP6V1E2 (NP_542384.1). LISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG | |
| 0.02 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 90423 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction