missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAFFR/TNFRSF13C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90011
This item is not returnable.
View return policy
Description
BAFFR/TNFRSF13C Polyclonal specifically detects BAFFR/TNFRSF13C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| BAFFR/TNFRSF13C | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| B cell-activating factor receptor, BAFF receptor, BAFF-R, BAFFRMGC138235, B-cell-activating factor receptor, BLyS receptor 3, BR3, CD268, CD268 antigen, CVID4, tumor necrosis factor receptor superfamily member 13C, tumor necrosis factor receptor superfamily, member 13C | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TNFRSF13C | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ | |
| 0.1 mL | |
| Cytokine Research, Immunology, Lipid and Metabolism | |
| 115650 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction