missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BDH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85218-25ul
This item is not returnable.
View return policy
Description
BDH2 Polyclonal antibody specifically detects BDH2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| BDH2 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| 3-hydroxybutyrate dehydrogenase, type 2, dehydrogenase/reductase (SDR family) member 6, Dehydrogenase/reductase SDR family member 6, DHRS6, EC 1.1.1.-, EC 1.1.1.30, EFA6R, FLJ13261, Oxidoreductase UCPA, PRO20933, R-beta-hydroxybutyrate dehydrogenase, SDR15C1,3-hydroxybutyrate dehydrogenase type 2, short chain dehydrogenase/reductase family 15C, member 1, UCPA-OR, UNQ6308 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL | |
| 25 μL | |
| Lipid and Metabolism | |
| 56898 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction