missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BMP-3b/GDF-10 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92033-0.02ml
This item is not returnable.
View return policy
Description
BMP-3b/GDF-10 Polyclonal antibody specifically detects BMP-3b/GDF-10 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| BMP-3b/GDF-10 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| BIP, BMP3B, BMP-3B, bone morphogenetic protein 3B, Bone-inducing protein, GDF-10, growth differentiation factor 10, Growth/differentiation factor 10 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 369-478 of human GDF10 (NP_004953.1). QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR | |
| 0.02 mL | |
| Cytokine Research | |
| 2662 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction