missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRAF35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | BRAF35 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609918
|
Novus Biologicals
NBP2-49621-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18694138
|
Novus Biologicals
NBP2-49621 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BRAF35 Polyclonal antibody specifically detects BRAF35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| BRAF35 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, Tumor Suppressors | |
| PBS (pH 7.2), 40% Glycerol | |
| 10362 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BRAF35Sox-like transcriptional factor, high-mobility group 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMGX2FLJ26127, HMGXB2member 1-related, SMARCE1R, SMARCE1-related protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title