missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C16orf46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00 €
Specifications
| Antigen | C16orf46 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C16orf46 Polyclonal specifically detects C16orf46 in Human samples. It is validated for Western Blot.Specifications
| C16orf46 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 123775 | |
| Synthetic peptides corresponding to C16ORF46 The peptide sequence was selected from the N terminal of C16ORF46. Peptide sequence LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 16 open reading frame 46 | |
| C16ORF46 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title