missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1qTNF3/CORS26/CTRP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | C1qTNF3/CORS26/CTRP3 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18605037
|
Novus Biologicals
NBP2-49434-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675847
|
Novus Biologicals
NBP2-49434 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C1qTNF3/CORS26/CTRP3 Polyclonal antibody specifically detects C1qTNF3/CORS26/CTRP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| C1qTNF3/CORS26/CTRP3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 114899 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C1ATNF3, C1q and tumor necrosis factor related protein 3, cartonectin, collagenous repeat-containing sequence of 26-kDa, complement C1q tumor necrosis factor-related protein 3, complement-c1q tumor necrosis factor-related protein 3, Corcs, Cors, Cors-26, CORS26, CTRP32310005P21Rik, FLJ37576, Secretory protein CORS26 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title