missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CA2 (Human) Recombinant Protein

Human CA2 partial ORF (NP_000058.1, 191 a.a. - 260 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00000760-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16033705

  • 359.00 € / 10µg
Estimated Shipment: 02-08-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Specifications

Specifications

NP_000058.1
carbonic anhydrase II
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CA2
GST
760
Wheat germ expression system
10 μg
CA-II, CAII, Car2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers