missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CACNA2D2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-81501-25ul
This item is not returnable.
View return policy
Description
CACNA2D2 Polyclonal specifically detects CACNA2D2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| CACNA2D2 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
| alpha 2 delta calcium channel subunit, CACNA2D, calcium channel, voltage-dependent, alpha 2/delta subunit 2, gene 26, KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2, LUAC11.1, voltage-dependent calcium channel subunit alpha-2/delta-2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9254 | |
| Human, Rat, Mouse | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CACNA2D2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction