missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ calmodulin-lysine N-methyltransferase Recombinant Protein Antigen
Shop All Bio Techne ProductsBeschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human calmodulin-lysine N-methyltransferase. Source: E.coli Amino Acid Sequence: SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen is derived from E. coli. The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 79823 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | calmodulin-lysine N-methyltransferase Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | C2orf34, calmodulin methyltransferase, calmodulin-lysine N-methyltransferase, Cam, CaM KMT, chromosome 2 open reading frame 34, CLNMTFLJ23451, EC 2.1.1.60, KMT |
| Gene Symbol | CAMKMT |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Mehr anzeigen |
For Research Use Only.
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?