missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calnexin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85520-25ul
This item is not returnable.
View return policy
Description
Calnexin Polyclonal antibody specifically detects Calnexin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Calnexin | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| calnexin, CNX, IP90FLJ26570, Major histocompatibility complex class I antigen-binding protein p88, P90 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI | |
| 25 μL | |
| ER Markers, Neuroscience, Unfolded Protein Response, Vision | |
| 821 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur