missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CaMKII beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
285.00 € - 549.00 €
Specifications
| Antigen | CaMKII beta |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Simple Western 1:5, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18484421
|
Novus Biologicals
NBP1-88212-25ul |
25 μL |
285.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18403381
|
Novus Biologicals
NBP1-88212 |
0.1 mL |
549.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CaMKII beta Polyclonal antibody specifically detects CaMKII beta in Human, Mouse samples. It is validated for Western Blot, Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CaMKII beta | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase, Wnt Signaling Pathway | |
| PBS (pH 7.2) and 40% Glycerol | |
| 816 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Simple Western 1:5, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| calcium/calmodulin-dependent protein kinase (CaM kinase) II beta, calcium/calmodulin-dependent protein kinase II beta, calcium/calmodulin-dependent protein kinase type II beta chain, calcium/calmodulin-dependent protein kinase type II subunit beta, CaM kinase II beta subunit, CaM kinase II subunit beta, CAM2CAMK2, CAMKB, CaMK-II subunit beta, CaM-kinase II beta chain, EC 2.7.11, EC 2.7.11.17, MGC29528, proline rich calmodulin-dependent protein kinase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title