missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Specifications
| Antigen | CAP1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231891
|
Novus Biologicals
NBP3-35444-20ul |
20 μL |
190.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231438
|
Novus Biologicals
NBP3-35444-100ul |
100 μL |
550.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CAP1 Polyclonal antibody specifically detects CAP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| CAP1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 10487 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| adenylyl cyclase-associated protein 1, CAP, adenylate cyclase-associated protein 1 (yeast), CAP1-PEN, CAPCAP 1, SSKAP55 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CAP1 (NP_006358.1).,, Sequence:, MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title