missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonyl Reductase 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
203.00 € - 472.00 €
Specifications
| Antigen | Carbonyl Reductase 2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18363753
|
Novus Biologicals
NBP3-09220-25UL |
25 μg |
203.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18354112
|
Novus Biologicals
NBP3-09220-100UL |
100 μg |
472.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Carbonyl Reductase 2 Polyclonal specifically detects Carbonyl Reductase 2 in Mouse samples. It is validated for Western Blot.Specifications
| Carbonyl Reductase 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| ML | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Carbonyl Reductase 2 (NP_031647). Peptide sequence VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 12409 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title