missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CASKIN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62674-25ul
This item is not returnable.
View return policy
Description
CASKIN2 Polyclonal antibody specifically detects CASKIN2 in Human, Mouse samples. It is validated for ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| CASKIN2 | |
| Polyclonal | |
| ELISA -Reported in scientific literature (PMID: 31330441), Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ANKS5B, CASK interacting protein 2, caskin-2, FLJ21609, KIAA1139 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR | |
| 25 μL | |
| Signal Transduction | |
| 57513 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction