missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBLL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 529.00 €
Specifications
| Antigen | CBLL1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18458710
|
Novus Biologicals
NBP1-83589-25ul |
25 μL |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18275496
|
Novus Biologicals
NBP1-83589 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CBLL1 Polyclonal specifically detects CBLL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CBLL1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Casitas B-lineage lymphoma-transforming sequence-like protein 1, c-Cbl-like protein 1, E3 ubiquitin-protein ligase Hakai, EC 6.3.2, EC 6.3.2.-, E-cadherin binding protein E7, HAKAIRNF188FLJ23109, MGC163401, MGC163403, RING finger protein 188 | |
| CBLL1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79872 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title