missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBP/KAT3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00 € - 500.00 €
Specifications
| Antigen | CBP/KAT3A |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18699195
|
Novus Biologicals
NBP2-38774-25ul |
25 μL |
302.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18164689
|
Novus Biologicals
NBP2-38774 |
0.1 mL |
500.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CBP/KAT3A Polyclonal specifically detects CBP/KAT3A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CBP/KAT3A | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Stem Cell Signaling Pathway, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CBPRTS, CREB binding protein, CREB-binding protein, EC 2.3.1.48, KAT3A, RSTS, Rubinstein-Taybi syndrome | |
| CREBBP | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q92793 | |
| 1387 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title