missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CBX6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92788-0.1ml
This item is not returnable.
View return policy
Description
CBX6 Polyclonal antibody specifically detects CBX6 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CBX6 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| chromobox homolog 6, chromobox protein homolog 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3). LLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV | |
| 0.1 mL | |
| Chromatin Modifiers | |
| 23466 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido