missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCDC24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-34179-25ul
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
CCDC24 Polyclonal specifically detects CCDC24 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones
| CCDC24 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q8N4L8 | |
| CCDC24 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAP | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Coiled-Coil Domain Containing 24, Coiled-Coil Domain-Containing Protein 24, RP5-1198O20.2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 149473 | |
| Human | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur