missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL1/I-309/TCA-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Spezifikation
| Antigen | CCL1/I-309/TCA-3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18453431
|
Novus Biologicals
NBP2-14459-25ul |
25ul |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18187031
|
Novus Biologicals
NBP2-14459 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
CCL1/I-309/TCA-3 Polyclonal specifically detects CCL1/I-309/TCA-3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| CCL1/I-309/TCA-3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C-C motif chemokine 1, chemokine (C-C motif) ligand 1, I-309, inflammatory cytokine I-309, P500, SCYA1Small-inducible cytokine A1, SISe, small inducible cytokine A1 (I-309, homologous to mouse Tca-3), T lymphocyte-secreted protein I-309, TCA3 | |
| CCL1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Chemokines and Cytokines | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6346 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts