missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCT6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46715
This item is not returnable.
View return policy
Description
CCT6A Polyclonal antibody specifically detects CCT6A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CCT6A | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P40227 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| acute morphine dependence related protein 2, Acute morphine dependence-related protein 2, amino acid transport defect-complementing, CCT6, Cctz, CCT-zeta, CCT-zeta-1, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine transport regulator 3, HTR3MGC126215, MGC126214, MoDP-2, T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, TCP-1-zeta, TCP20, TCPZ, TTCP20 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVL | |
| 0.1 mL | |
| Signal Transduction | |
| 908 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction