missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD161 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88130
This item is not returnable.
View return policy
Description
CD161 Polyclonal specifically detects CD161 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CD161 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q12918 | |
| KLRB1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH | |
| 0.1 mL | |
| Innate Immunity, Signal Transduction | |
| 3820 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD161, CD161 antigen, CLEC5BC-type lectin domain family 5 member B, HNKR-P1a, killer cell lectin-like receptor subfamily B member 1, killer cell lectin-like receptor subfamily B, member 1, Natural killer cell surface protein P1A, NKR-P1, NKR-P1AMGC138614, NKRP1ANKR | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction