missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD53 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14464-25ul
This item is not returnable.
View return policy
Description
CD53 Polyclonal antibody specifically detects CD53 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CD53 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| antigen MOX44 identified by monoclonal MRC-OX44, CD53 antigentetraspanin-25, CD53 glycoprotein, CD53 molecule, CD53 tetraspan antigen, cell surface antigen, Cell surface glycoprotein CD53, MOX44transmembrane glycoprotein, Tetraspanin-25, tspan-25, TSPAN25leukocyte surface antigen CD53 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS | |
| 25 μL | |
| Immunology | |
| 963 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction