missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD59 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-89405-25ul
This item is not returnable.
View return policy
Description
CD59 Polyclonal specifically detects CD59 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| CD59 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| P13987 | |
| CD59 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG | |
| 25 μL | |
| Cell Biology, Cellular Markers, Immunology, Signal Transduction, Stem Cell Markers | |
| 966 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 16.3A5, 1F5, 1F5 antigen, 20 kDa homologous restriction factor, CD59 antigen, CD59 antigen, complement regulatory protein, CD59 glycoprotein, CD59 molecule, complement regulatory protein, EJ16, EJ30, EJ30, EL32 and G344), EL32, FLJ38134, FLJ92039, G344, HRF20, HRF-20, human leukocyte antigen MIC11, Ly-6-like protein, lymphocytic antigen CD59/MEM43, MACIF, MAC-inhibitory protein, MAC-IP, MEM43, MEM43 antigen, membrane attack complex (MAC) inhibition factor, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, MGC2354, MIC11MSK21, MIN1, MIN2, MIN3, MIRL, p18-20, protectin, surface anitgen recognized by monoclonal 16.3A5, T cell-activating protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction