missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdc14A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-84573
This item is not returnable.
View return policy
Description
Cdc14A Polyclonal specifically detects Cdc14A in Human, Monkey samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| CDC14A | |
| Affinity Purified | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRAL | |
| RUO | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction